PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11409_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 120aa    MW: 13980 Da    PI: 9.977
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11409_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822162.52.6e-50277176
                               DUF822  1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76
                                         ++++r ptwkErEnnkrRERrRRaiaa i+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrk  ++ 
  cra_locus_11409_iso_5_len_566_ver_3  2 TSGTRLPTWKERENNKRRERRRRAIAANIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKDASQW 77
                                         5899******************************************************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.6E-47376IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAANI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKDASQWTEW ISWGDQQRQV HAPLINQVLE PPTTQVLHPP LSQVQLLLML
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455701.14e-45PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
RefseqXP_012455718.14e-45PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
SwissprotQ9ZV888e-30BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A068UCW31e-46A0A068UCW3_COFCA; Uncharacterized protein
STRINGGLYMA12G36060.11e-31(Glycine max)